NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193709_1118359

Scaffold Ga0193709_1118359


Overview

Basic Information
Taxon OID3300021411 Open in IMG/M
Scaffold IDGa0193709_1118359 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)546
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9821Long. (o)-107.0102Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037137Metagenome / Metatranscriptome168Y
F061299Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0193709_11183592F061299AGGTGGMSDSVPDGDQQQSLQTEMKERAELISVVLTTVLEEAGYASAVDQARKLFAHTTPAQMEQMKPHFSSLDLEFMILAGFFKD
Ga0193709_11183593F037137AGGAMDELTREQEEAVAATVGAIQRIAMAIVALPKEQRTAHYALVRRQFEAAITEFGIEGAMAHAWLSSTIIGIETLVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.