Scaffold Ga0224422_10208010

Overview

Basic Information

• Taxon OID: 3300021400
• Scaffold ID: Ga0224422_10208010
• Source Dataset Name: Sheep rumen microbial communities from New Zealand - Tag 1265 SPADES assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 6088
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (12.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → unclassified Prevotella → Prevotella sp. E9-3 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location

• Location Name: New Zealand
• Coordinates
  • Lat. (^o): -42.26
  • Long. (^o): 171.6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059440	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224422_102080102	F059440	N/A	MNRKERKSEFRAKIAELDAYVEELNAKGNLTDEEWKEVWSAMLQTNRYLRAIGAPESEMYDI