Scaffold Ga0213864_10096148

Overview

Basic Information

• Taxon OID: 3300021379
• Scaffold ID: Ga0213864_10096148
• Source Dataset Name: Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1464
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 34.7181
  • Long. (^o): -76.6707
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090233	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0213864_100961482	F090233	N/A	MKVRVHGKNLPKKFRLGVYGMTELTIRDLLDNRRVVKNLEIDIHFRHHADNGEAMIHENEFRSRPRMFRVIIDPYKTRVDDYGRELSDEEHANEMFKVLGHELVHVKQYVVGDLSMRSKGMYWKGELTKIDNMMEYFKSPWEIEAYGLERYLWMNFIDFWSNNIEENIT