Scaffold Ga0213874_10251207

Overview

Basic Information

• Taxon OID: 3300021377
• Scaffold ID: Ga0213874_10251207
• Source Dataset Name: Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 652
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location

• Location Name: Brazil: Minas Gerais
• Coordinates
  • Lat. (^o): -19.2822
  • Long. (^o): -43.5936

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029132	Metagenome / Metatranscriptome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213874_102512072	F029132	N/A	ATDGVPGDGYKAQVTVIRFDDGAHLQMDASSILEQTAPDPGGGIGGYLVTFNGMVGFAADHPDRSRIEKLEDEEIGYDLAFIHEDTGRIAVEGEDYEFKDRPRGMAHKITKRHGSERVER