Scaffold Ga0194130_10114548

Overview

Basic Information

• Taxon OID: 3300021376
• Scaffold ID: Ga0194130_10114548
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1727
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum → Leptospirillum sp. Group II (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -4.8369
  • Long. (^o): 29.6087
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003459	Metagenome	485	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194130_101145483	F003459	N/A	MNQELVTIPKADISKADISAIATGLIFRIQEGEVNPVAAHVRLKAVIKALEQVLRSTEDIVRDEAEKNGRTFSAFGAEIQLKEGALTPDYTVDKEWASLNSMMKGREELLKAAFRNAGKMTVIDEATGEVVPVCPAKGTKPSIAVTFK