Scaffold Ga0213860_10218631

Overview

Basic Information

• Taxon OID: 3300021368
• Scaffold ID: Ga0213860_10218631
• Source Dataset Name: Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 838
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 34.7181
  • Long. (^o): -76.6707
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059455	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213860_102186313	F059455	N/A	MKVISKEIIGTTEWSEGRTRKELSKQTFWSSSKDFSGLSGLEINGYTFNNHVKCTAITSQGRSQNKYFTIPVDKVEEFCHNLMEAKKFVERQGNE