Scaffold Ga0213872_10081003

Overview

Basic Information

• Taxon OID: 3300021361
• Scaffold ID: Ga0213872_10081003
• Source Dataset Name: Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1459
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location

• Location Name: Brazil: Minas Gerais
• Coordinates
  • Lat. (^o): -19.2822
  • Long. (^o): -43.5936

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023771	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213872_100810031	F023771	AGAAGG	MPLYYFHLSFGDRTVPDDEGVELPNRSAAREEAAAVVRDLTNPEVAGNPRRWASWFLQVADEAGEFLRMPIGHPALELVTSDGQQPQAESSEMKPVLLAATVATRQGRRSAALVQQMSAVRKQTEQLLQRNQQLRHELSTLCLVSESIRVRASRLVSLARLAGAPADDVYRIANKPPRRSSPHLVVLPGR