Basic Information | |
---|---|
Taxon OID | 3300021357 Open in IMG/M |
Scaffold ID | Ga0213870_1127822 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from subterranean cave lake in Wind Cave National Park, South Dakota, United States - WICALVC2017 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 774 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_63_8 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: South Dakota | |||||||
Coordinates | Lat. (o) | 43.5566 | Long. (o) | -103.4781 | Alt. (m) | Depth (m) | 200 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046951 | Metagenome / Metatranscriptome | 150 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0213870_11278222 | F046951 | AGGAGG | VKGIVVGLQTFLLFLSTVAVVFAEEAAGAEGGGDPYAGMYYVWYALIGIIVAWGIYDSFFRPID |
⦗Top⦘ |