NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213870_1118670

Scaffold Ga0213870_1118670


Overview

Basic Information
Taxon OID3300021357 Open in IMG/M
Scaffold IDGa0213870_1118670 Open in IMG/M
Source Dataset NameFreshwater microbial communities from subterranean cave lake in Wind Cave National Park, South Dakota, United States - WICALVC2017
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)811
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: South Dakota
CoordinatesLat. (o)43.5566Long. (o)-103.4781Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065589Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0213870_11186701F065589GGALKLSMPTIFEEEESKPRCPDCSQQLTFIRTKSHQKRWYCYACERYIDQPSHATLTKHAYARLEALSGLQVIDSHGMIVGRVRKAISNDMGDIRSLVLSVDKEQFKTLLDDRDLPWEFEIEHGKIATVGDVVILSDVFSLSALAPAKPPEEMSKDKRCGKCGTPLLADAKHCIKCGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.