Basic Information | |
---|---|
Taxon OID | 3300021357 Open in IMG/M |
Scaffold ID | Ga0213870_1000257 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from subterranean cave lake in Wind Cave National Park, South Dakota, United States - WICALVC2017 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 28184 |
Total Scaffold Genes | 32 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 22 (68.75%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: South Dakota | |||||||
Coordinates | Lat. (o) | 43.5566 | Long. (o) | -103.4781 | Alt. (m) | Depth (m) | 200 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096967 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0213870_100025710 | F096967 | N/A | MVRRLLEGPWGEQPSDSDTPYLLGVAHFLLYNPDQSLAWFERCLANETQSGDSPQRLDCLYWSGRAGAMKAAFAWYYRESILEGLVKSRRAIGAALDRYEHVLSKAPDHVGAMLSQAEYYMAAPYLPPLAYGDVVTARALVARALALEVDNPRAQYLQARLDLYANNRRDQARAGYARVRHLLERGIGGLEIVLLQRWVDFAQAEVAFLDQDYPAAIAYADAYIRQVPDGADGYALKGASLKFLGQEADGEAQIKKAREFNPRVRRYREP |
⦗Top⦘ |