Scaffold Ga0213858_10011412

Overview

Basic Information

• Taxon OID: 3300021356
• Scaffold ID: Ga0213858_10011412
• Source Dataset Name: Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4192
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 → Synechococcus phage S-SKS1 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 34.7181
  • Long. (^o): -76.6707
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011477	Metagenome / Metatranscriptome	290	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213858_100114127	F011477	GGAGG	MTLAAFMAWVAANEVALATIALILSELLGAVPKFKSNGLVSFVLVQVREQLRKRGAKDPTPESK