Scaffold Ga0206690_10787544

Overview

Basic Information

• Taxon OID: 3300021355
• Scaffold ID: Ga0206690_10787544
• Source Dataset Name: Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 765
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.7468
  • Long. (^o): -122.0193
  • Depth (m): 150

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074919	Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0206690_107875441	F074919	GGA	MHGLLGWGQYLGGCTCVADPVGVPVLGGIVDNKLTGLAHSAFLVNATYLGRIKLGIEYANFKLGDKTPNWFDAMKHKKDMIVDHYSKWFLHLFVDADPESPTYTQPVRFYGPYSGFAKYVSFEKKQPPPEVFYTACVDNGWGTEEIKPFHPCKGKTLDNYKCMNVEKKHPEVCAPYENGAGSAEIAETIQGAFGNIIIPANAAINV