Scaffold Ga0194047_10007924

Overview

Basic Information

• Taxon OID: 3300021354
• Scaffold ID: Ga0194047_10007924
• Source Dataset Name: Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5552
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Canada: Ontario
• Coordinates
  • Lat. (^o): 49.701
  • Long. (^o): -93.727

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045569	Metagenome	152	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194047_100079242	F045569	N/A	MEIDPVKFGVTWQKVEAMEQEVAELRKDVKELLELANKGRGGLWAGMMVVSAISAFIGFISHYITGK