Basic Information | |
---|---|
Taxon OID | 3300021353 Open in IMG/M |
Scaffold ID | Ga0206693_1727182 Open in IMG/M |
Source Dataset Name | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 521 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 36.6907 | Long. (o) | -122.3448 | Alt. (m) | Depth (m) | 80 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000248 | Metatranscriptome | 1460 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0206693_17271821 | F000248 | N/A | IHWSTTRFSDMNSALILASLFCGASSALVKNKLDINQKAYIEGQAVLGDGAGQGNLNVCMELADHFVNNPNAPEVKVCGTGIKMTVYLLGRCGEGSLTAAKMAHTWDIGACDTGKPPSTCANYGPSNDKRMGVSQSYKITQC |
⦗Top⦘ |