NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213867_1058760

Scaffold Ga0213867_1058760


Overview

Basic Information
Taxon OID3300021335 Open in IMG/M
Scaffold IDGa0213867_1058760 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1451
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001588Metagenome / Metatranscriptome667Y
F009668Metagenome / Metatranscriptome314Y
F020852Metagenome / Metatranscriptome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0213867_10587602F020852GAGGMLTLKNKTTTTTHADEDYSCVVTRWDADGFAQCNGSSIWGYTGDLQVPVSAVEVHNITYEDGDTSTMLYVEHNAGGTGDWRIYTDDGFEESISKALGFDVTFTEQGMQDDGVASLET
Ga0213867_10587603F009668AGGAGGMLNGKVCLSEAVRVIWVEEDAEWKAEFEAYGYDTDMWATYGEFDEEWREDVYTIEVLEDETFGFICGNEHDRRVYGFTVDVYKAEEADGSFSFWVTNEDYATIG
Ga0213867_10587604F001588GAGGMQNNVFLNAENAAIVVTVNNKVVAIDVQTADALVEVFLQHNVNVLTDVIMCSSSIDFATEADFATDSCAHNIIDAALEQLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.