NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213867_1038606

Scaffold Ga0213867_1038606


Overview

Basic Information
Taxon OID3300021335 Open in IMG/M
Scaffold IDGa0213867_1038606 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1867
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009045Metagenome / Metatranscriptome324N
F072288Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0213867_10386063F072288AGGAGGMREFDSNGELDILEEIRDEILNKLDEGLRDTPYSTFTKNYLAKSLVDRGLADSRALPIAQAIEDNDMNALAFAVCACDSWNFPHLLKIEPRIFYMLLCEETDPVLIARLEEVMK
Ga0213867_10386064F009045GGAGMNKLSENFTPSRTSRGNRHIVKGQIIQGDEYVVDGIRRAFWSNPDGSHSCHLFRLVRGEVIDRITVDSWEGEGLNEFALRTESIILGGSK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.