Scaffold Ga0210308_1079771

Overview

Basic Information

• Taxon OID: 3300021303
• Scaffold ID: Ga0210308_1079771
• Source Dataset Name: Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1324
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Convolvulaceae → Ipomoeeae → Ipomoea → Ipomoea triloba (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 46.233
  • Long. (^o): -123.909
  • Depth (m): 9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073578	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0210308_10797712	F073578	N/A	SSNNNNKKNDHGASLYAHQFAEEAKEEEMEATAGAMLPQDAKKKYVVGSSKVKYQQKKAAVIMMPPQDGNDSSNIFVPAVSSSTADVVAAPSQQHLRPGAFAVRGSGFIPQDDSFLHVDTAPSTSTKNVQDELKQLEPESLFKAVLVDDPEIPSASIFDYEAAEKAYCRRQGWKVLATFVMIGILGAIIAIVILLKPKPPSPTSSPTLSPTSSPLFDFLVEHHLIMEQHFQLLALHKKRH