Scaffold Ga0210299_133328

Overview

Basic Information

• Taxon OID: 3300021284
• Scaffold ID: Ga0210299_133328
• Source Dataset Name: Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 621
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 46.217
  • Long. (^o): -123.781
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039672	Metagenome / Metatranscriptome	163	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0210299_1333281	F039672	N/A	GIFGADTRSFWALVSHFQWRKMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVTSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRV