Scaffold Ga0213897_101660

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213897_101660

Scaffold Ga0213897_101660

Overview

Basic Information
Taxon OID	3300021271 Open in IMG/M
Scaffold ID	Ga0213897_101660 Open in IMG/M
Source Dataset Name	Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Cave_3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	639
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States

Source Dataset Sampling Location
Location Name	USA: West Virginia
Coordinates	Lat. (^o)	39.458	Long. (^o)	-79.073	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062864	Metagenome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0213897_1016602	F062864	AGGAG	VRYTYTNPQLERERDAVLRTILDKRGMCTFLARELGISKAAVAQWYSIPEHHVAAISKLLDIPQYQLRGEPSPRAKVDA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.