Scaffold Ga0223824_10071543

Overview

Basic Information

• Taxon OID: 3300021254
• Scaffold ID: Ga0223824_10071543
• Source Dataset Name: Sheep rumen microbial communities from New Zealand - Tag 1494 SPADES assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3174
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location

• Location Name: New Zealand
• Coordinates
  • Lat. (^o): -42.26
  • Long. (^o): 171.6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072829	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0223824_100715437	F072829	GGAGG	MKNFYDQLIDEYFKRHPDAGLAWWMLPLNEQPEGFKQEMYDIMWDLTHKEETND