Scaffold Ga0206682_10022951

Overview

Basic Information

• Taxon OID: 3300021185
• Scaffold ID: Ga0206682_10022951
• Source Dataset Name: Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3903
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.6907
  • Long. (^o): -122.3448
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077923	Metagenome / Metatranscriptome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0206682_100229511	F077923	N/A	MGLIKFKHYTKTIAIVRNHKCSTTTMLSYVAQALWNADPKEEQFYQNFQNERPGIYNKARSFLQFKDELLSSDLRIALWRDPVEKFVSGFYHTMSNPANKNLWIKTPSLLNFVKDIDVYRQNPNVADHCETNTARLGPDRSIYTHIYNYKQVHKIAELLGVPALDTHHRKDNTMRAGPTDLQKLRIKQVMLEDYVNGWC