Scaffold Ga0210396_10099112

Overview

Basic Information

• Taxon OID: 3300021180
• Scaffold ID: Ga0210396_10099112
• Source Dataset Name: Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2637
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location

• Location Name: USA: Massachusetts
• Coordinates
  • Lat. (^o): 42.481016
  • Long. (^o): -72.178343

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009018	Metagenome / Metatranscriptome	324	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210396_100991125	F009018	GGAGG	MTRHIRSIPMALAIAVLALMSSAAMAQSYTGKWPATVTKSQRDNGKNCITLTDDRSYGFRHSGEAVLNGQNNGYPGYFTVVDGIMTVTFTFPSGEGDCCSYVVFTAPASNGEIGKGVFNYLGITDIGVLNFGKKNGCTV