NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210405_10008897

Scaffold Ga0210405_10008897


Overview

Basic Information
Taxon OID3300021171 Open in IMG/M
Scaffold IDGa0210405_10008897 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8644
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022957Metagenome / Metatranscriptome212Y
F090135Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0210405_100088975F022957GAGMTSNRQRQILGLTVMAVVGVGLGIWLLRGGFLALGCLFVGAFLWRGQQFVVWFLAPAKAPSGVTPPLTSAWQRLLLSIVCLLAAAVCALGIYLWRLWPEQWQAGLVFVLFGLLVLAPVTIKEIQSRRRSLAQSSTPD
Ga0210405_100088978F090135GAGMGAKGLFGLGALAFWLPEIALYAWQRQALNAKLVTFLLPGTFLLVYLLVSILRQKRISNPSAAIFMVLGVVFLGTLAMTIGATIRGAGFWGHPGSTLLGALLGTVVPIYAFIAATYDGSLYALIFVSILMPLVHLVFERQNWIIPPKKDSEHLND

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.