NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210400_10000231

Scaffold Ga0210400_10000231


Overview

Basic Information
Taxon OID3300021170 Open in IMG/M
Scaffold IDGa0210400_10000231 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)69046
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)40 (70.18%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025089Metagenome / Metatranscriptome203Y
F103602Metagenome / Metatranscriptome101N
F105555Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0210400_1000023144F103602N/AMDIDIKERIAALCAKVIAAPDGSEELSCTMEELRSALSEHAKNMRRQIVNLRQKGFPHSDDTGER
Ga0210400_1000023146F105555AGGAGGMKIKEEPKQVRLPHSNNPSRKKHYEAPKFTILGRDQAEAQLVASARAGDRDAERMLVLASGLVSKTDKNCR
Ga0210400_1000023148F025089GAGGMSSVPLAPIQRLIHDVTGDLHVVVAASKEGYRETALEACLLAKEKLQAIREELLRPEPGIADPRHDYDS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.