NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210406_10000282

Scaffold Ga0210406_10000282


Overview

Basic Information
Taxon OID3300021168 Open in IMG/M
Scaffold IDGa0210406_10000282 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)74060
Total Scaffold Genes77 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)34 (44.16%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003634Metagenome / Metatranscriptome476Y
F008277Metagenome / Metatranscriptome336Y
F048375Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0210406_1000028223F008277N/AMMQRLVRDAMNNIRQPAEPKPELVECAIVELLDLAERQGITPADFIQLLDSGMQISDFLAAMNPLENGNGTADCDS
Ga0210406_100002823F048375GAGMGRQTQLHVLPKDLNELLVAMRDKEPLEVALRLGNSATPERQSFIPDNMSGQSLVLWSERFAPNLQRRFVATADSPYYLADEQTEPVFELSLSGVTTWEGRPALTQGRIYGVFQNKQADFEKCYEQIISYIRRHWRKNPATWMGGYVGPAAGDWFDRGGLLLPNYIPPVRNDWIQRLGEQHPTD
Ga0210406_1000028256F003634N/AMNFLTNVFSSMPLHWWVAIIIFALGIAAICLRVFESDGVRAKRAERNKKKELRSLAEKISSYGHSVHKQYPTGNVIVSEQDLAEQLRTRPDTVATALNLLLGEQKVQRATLSGYWKLNV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.