NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210406_10000033

Scaffold Ga0210406_10000033


Overview

Basic Information
Taxon OID3300021168 Open in IMG/M
Scaffold IDGa0210406_10000033 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)213692
Total Scaffold Genes211 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)160 (75.83%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001474Metagenome / Metatranscriptome688Y
F006195Metagenome / Metatranscriptome379Y
F025166Metagenome / Metatranscriptome203Y
F090674Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0210406_10000033127F006195GGAMAKSEKSSFQLKILYGEGDAQVLVSQALAIQKAGHQVETAVGRKAIDEAARRGGFDLVVLGSTLTKNDRHHLPYVIKKAQAATRILVMHTDGEGHPAVDANLDTGRSIADVVAKIASMMTTGEIASNGLAKGAAAGR
Ga0210406_1000003313F090674GAGGMSEQELVFHVKELHVISLTCSHCGHGTIFDFKSSDYLEKSVSPQCAICKTELAVDLQEQLKAYRCFYDSMSLCERVEFRVRLKNPEVAPPESATDIQQAVSTAVAEVQDAVVKALAKETA
Ga0210406_10000033173F025166AGGAGMKHLRYLAVLSVFAMLSSLSVFARNKNQQSVDIPGTVKVGDTQLKPGNYKMEWQGTGPDIQVTFLRDGKTVVTVPATLKTNDDQVTQDGIVTDSENNTLKEVDFRRGKEAVVFQQSGM
Ga0210406_1000003324F001474GAGGVKRLMLALAAYVALGILSWTTISDQRIRLATVAILVMFAFKTWVRRKDVLHSDGSESK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.