Scaffold Ga0214163_1085077

Overview

Basic Information

• Taxon OID: 3300021141
• Scaffold ID: Ga0214163_1085077
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 753
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, WI
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080905	Metagenome	114	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0214163_10850771	F080905	N/A	FTSTVTSGANRSTHHDLQIDIDGALKTVEFKGSMHFKQIDATKAPWTNGVQFYNGPGNKFKVGSLYAKKFYDECLDKIIVDLELKTPKPSYEEWVKDAFRQGKPKTPFVCELREKGYCGDYLSDARKQFNKSFMLSTFELTDLMIEVQKISEEVLNCKDFWLQIHGDIDDPDKFHVKWTNKIVMPEIVSVEQLKSKDNCDINFKFICDDNSEFFAKMRWGYGQCITNIRIDIK