NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214168_1043421

Scaffold Ga0214168_1043421


Overview

Basic Information
Taxon OID3300021140 Open in IMG/M
Scaffold IDGa0214168_1043421 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1095
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, WI
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F011938Metagenome / Metatranscriptome285Y
F013878Metagenome / Metatranscriptome267Y

Sequences

Protein IDFamilyRBSSequence
Ga0214168_10434211F013878AGGMLNLTELGVEVFIKKAKSITPFWDNYDLVIWKKDINGFTNVKGMFKENAWGTAERISVDSDGIWKLPTKHVKHFK
Ga0214168_10434213F000473GAGGMFINKKDINEHFKYGINEWTGEPNKPVFYTEEMRKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVIDYVGKIKRLLESYGVRCELEGKPSEKVL
Ga0214168_10434214F011938GGAGGVKKYYDTTHVVYIHSEKCHGTVEKLGAWASIVKYNKDGMEYSELMENEEFSIIDEIVFTHIEESE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.