NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214206_1001172

Scaffold Ga0214206_1001172


Overview

Basic Information
Taxon OID3300021131 Open in IMG/M
Scaffold IDGa0214206_1001172 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)6262
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (94.12%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003439Metagenome / Metatranscriptome486Y
F019636Metagenome / Metatranscriptome228Y
F070899Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0214206_100117211F003439AGGAMTVNNSRSQNMSLDEGATDGKYRKARPNTTVIPGLGDQKVKQERAGLHPYMNYGFINSEEQAKVNPGK
Ga0214206_100117212F070899GGAMTKDAGLLTDSTGDGMAGAEDVRLDTQRDLSQTYYNGSKPCIECGLVLNPVQSLHSDMCPNCNRRKAAHLVKGMMA
Ga0214206_100117214F019636AGGAGMTGRMSDGVYSRKPWQAPPEAAYPPQQYVGPFASNQERLLSQSMAVNMMTGQEIQELVRPPLPQVRLFPDRYGYTDSELTIEDIIALPRVNQQRVESDFSQTPNTQESTSTNSLGGSI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.