Scaffold Ga0194133_10336357

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194133_10336357

Scaffold Ga0194133_10336357

Overview

Basic Information
Taxon OID	3300021091 Open in IMG/M
Scaffold ID	Ga0194133_10336357 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	883
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location Name	Tanzania: Lake Tanganyika
Coordinates	Lat. (^o)	-4.8915	Long. (^o)	29.586	Alt. (m)		Depth (m)	40
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039497	Metagenome / Metatranscriptome	163	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194133_103363573	F039497	N/A	LMSEDNLNCQAGNQLRNILYKDILRYAHESDMTAYQVIGVLESLKFDLLNAMVESGKDNEDEI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.