NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206684_1005438

Scaffold Ga0206684_1005438


Overview

Basic Information
Taxon OID3300021068 Open in IMG/M
Scaffold IDGa0206684_1005438 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4648
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.6907Long. (o)-122.3448Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066233Metagenome / Metatranscriptome127N
F080617Metagenome / Metatranscriptome115N
F099229Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0206684_10054384F080617N/AMEDNKLKWSLEKLLNTVGRNLAMNYYGFDSEYEVVSIIDEKTGEEVTDFNFGDTENYTAIVRAKEILPEIFDVKIEPLFRYGKYAQPMDLQFNLENLTKYISPNQIAIQLVGPEWKPGENTFRTLQSFEDKWGRSLDRDANDFKANPDAWIELNNGSVVDKLTGDSFPLMFNGLIDKTEMWNIARVDDDEWWGSLTDLDKERLTDNFS
Ga0206684_10054385F099229N/AMDKDIDKIVEIGKVLLNTPTLRSIYKDKFEINSIDFEFVEKTSNSQFTAQYEHYIFKVTLYTDISLNFDEGIRSGEIEGYDEIENEIWEYGIDPFYLADVIIPEQILNIILPKGKNGPKVAIELSIIGDEGQVIWNDHMFGRPASSQFH
Ga0206684_10054386F066233N/AMELENSLDSELKVEAQEKGKMAVKVLDALVFSKFGGIEYSMMIRKNRANWQNTASDTIPFYFEFDVDIDVDKTFEPSPTYDKKYGEYIYEIGDHIGRALRYVNLQDYMDEPMFTYVNDELVDNEIDRLENKLILYLQSQYEGLSYDSIREADIGYYLYKGETDNPYMRVEYVGQPPLRDGDRQSTDTIEEREYFSCDDLYDIMSDLFDRSPLSISYDGENFTCQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.