NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206227_1100678

Scaffold Ga0206227_1100678


Overview

Basic Information
Taxon OID3300021063 Open in IMG/M
Scaffold IDGa0206227_1100678 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)569
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.96Long. (o)-106.99Alt. (m)Depth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014009Metagenome / Metatranscriptome266Y

Sequences

Protein IDFamilyRBSSequence
Ga0206227_11006782F014009N/AMTLCRSCREELASEFRYCPWCAAPLRRKLVEFFRGADADARRALRVSRYLPEQRVRFSVWDESGTARAAVTLDDDEAARLATYLAPASPRSSLIRELRALVRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.