Scaffold Ga0206224_1039505

Overview

Basic Information

• Taxon OID: 3300021051
• Scaffold ID: Ga0206224_1039505
• Source Dataset Name: Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 612
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Colorado
• Coordinates
  • Lat. (^o): 38.96
  • Long. (^o): -106.99
  • Depth (m): 50

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074060	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0206224_10395051	F074060	AGGGGG	VLNSPAAGEYNGRMLERIAVLLRQKKAVGTLLADLTAEVVRLVPADWLRYDLEDQGKLWSRSIKPGSDPARPGLGEVPRIGSRETEYAKPIEGGFEACLLIGIGEPTGRLLLRRKTSPFTDDEMKRLRTVADVLSLGLRARPFEPPAKLRGPFEDGPM