Basic Information | |
---|---|
Taxon OID | 3300021046 Open in IMG/M |
Scaffold ID | Ga0215015_10308398 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Colorado |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1446 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Czos Across The Us |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Huntingdon County, Pennsylvania, United States | |||||||
Coordinates | Lat. (o) | 40.6949 | Long. (o) | -77.9199 | Alt. (m) | Depth (m) | .9 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002535 | Metagenome / Metatranscriptome | 551 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0215015_103083982 | F002535 | AGG | MNREELNWLLQTIQDAETAERFVLAQYERGRISPQMMAEVARERGWINLNANQFLTTATCHLSEYAKTELSIA |
⦗Top⦘ |