NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214277_11164832

Scaffold Ga0214277_11164832


Overview

Basic Information
Taxon OID3300020818 Open in IMG/M
Scaffold IDGa0214277_11164832 Open in IMG/M
Source Dataset NameFood waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Toronto
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)713
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location NameUniversity of Toronto, Toronto, Ontario, Canada
CoordinatesLat. (o)43.6629Long. (o)-79.3957Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014592Metagenome / Metatranscriptome261Y
F099086Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0214277_111648321F099086AGGLFAICNSNVVVSCLTSDPAKTSSGPQPKGDDKIKKMAEDIMDEVVNRLLNEAAEVVLRED
Ga0214277_111648322F014592N/AWIDHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEAALSFEDARDPSAEASIIGGKFFTDIWDNGGREMAGEIIRRSEKGIHDAREVAEAAEKSAEAEGQLGIN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.