NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214088_1847138

Scaffold Ga0214088_1847138


Overview

Basic Information
Taxon OID3300020814 Open in IMG/M
Scaffold IDGa0214088_1847138 Open in IMG/M
Source Dataset NameGranular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Toronto
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1820
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → unclassified Microgenomates group → Microgenomates group bacterium GW2011_GWF1_44_10(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location NameUniversity of Toronto, Toronto, Ontario, Canada
CoordinatesLat. (o)43.6629Long. (o)-79.3957Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021489Metagenome / Metatranscriptome218N
F049316Metagenome / Metatranscriptome147N

Sequences

Protein IDFamilyRBSSequence
Ga0214088_18471381F049316N/AAEFTGKTLSAIYRDALDEYFDRFVDTQLYLAINNYFAKLYFQYDIGTPDIYNIIMSGKLADTAMIIAEAVKQLPQEPKAQELIDEGMRLISILSK
Ga0214088_18471383F021489AGGAGMSIERKIGSVQEYNLLKLLKANSDLKRFGVEWIKLDHNLCRAFATNSYALIIAELEPNQWHDIFDGLPELVFITKLKRDEVHYFEAKELEKFNYLSVFEAVGKEPNYQPVMHFDLELLRNLTDKFDDVYFVKQSGLALFMKLEGDKYPAGSYYGALMPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.