Basic Information | |
---|---|
Taxon OID | 3300020814 Open in IMG/M |
Scaffold ID | Ga0214088_1142817 Open in IMG/M |
Source Dataset Name | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Toronto |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3735 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge → Metagenomes From Anaerobic Digester Of Solid Waste |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Toronto, Toronto, Ontario, Canada | |||||||
Coordinates | Lat. (o) | 43.6629 | Long. (o) | -79.3957 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F076867 | Metagenome | 117 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0214088_11428172 | F076867 | GGA | MDEKNRNLVEIAKKKRYIALVEKLGRGSLSSKELKELEEFEKSEQRPAGVIDGTVDLPTLCVYLEKSPRMIRRYVQQGMPVFRDAVGEIARFKVGDVFKWFYKKQGSEEDNGKDYWDKEYRKNRAKLSEIELKQKEGEVIPFEDHVSIVKNQIRGIKAGFLRLPKHIAPKLYQQDPKVICEMLDQEIRYIIEQFAGKQNANKAGKGNS |
⦗Top⦘ |