Scaffold Ga0214219_1067969

Overview

Basic Information

• Taxon OID: 3300020735
• Scaffold ID: Ga0214219_1067969
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 501
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas nitroreducens/multiresinivorans group → Pseudomonas nitroreducens (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.041
  • Long. (^o): -89.686

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020528	Metagenome / Metatranscriptome	223	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214219_10679691	F020528	N/A	IAQHYWICDPTTPEMKDQPFCGFYDPMTIQEVCELYPGVDLAEIEVHAQYNMNGAYQAGSVLNNLAIHARDSVPVMGIPVSSAASADPDSRMVSVVTVWNRFDIDGDGEMELIEIVYTGSYIISAKEVEFIPVANMCPKPLPGNFYGMSIAESVIPMQEYNTSAAR