Basic Information | |
---|---|
Taxon OID | 3300020693 Open in IMG/M |
Scaffold ID | Ga0214226_1002615 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Trout Bog Lake, WI - 01OCT2007 hypolimnion |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2410 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Trout Bog, Vilas County, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 46.041 | Long. (o) | -89.686 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029410 | Metagenome / Metatranscriptome | 188 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0214226_10026152 | F029410 | AGG | MKYYDIDEVPIPFDPTWSSIAISLSGGADSALLSYLLCDIAKNYQTKINIINHVRCWKTRPWQQYNADQVFDWLFQKFYDTEFIRHTNFIAPELEYGNIGPSLTDEYGKNVSGDNIQQRAYAEFICHKHDIPAYYNGVTHNPTSIDFNGMKERDVELNDNTRHLLVMKHMGRWALHPFRFTDKSWVIKQYKRLNIEDLLHITRSCEGEFTGLNYQTYMKGQDVPECGECFWCKERKWAIEQNK |
⦗Top⦘ |