NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214169_101169

Scaffold Ga0214169_101169


Overview

Basic Information
Taxon OID3300020677 Open in IMG/M
Scaffold IDGa0214169_101169 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 13JUN2007 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1720
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008991Metagenome / Metatranscriptome324N
F010534Metagenome / Metatranscriptome302N
F036561Metagenome / Metatranscriptome169N

Sequences

Protein IDFamilyRBSSequence
Ga0214169_1011691F008991N/AMHLTVKITEQVEKKLEAVLKGKYDNKTIWMYYKVSLQLLRDIIENLITCHHTTYPLAEKDLYYEQNKVQIVDWIQWIQNRTSSDKLVDLDKLLSKLIKDKAENLVEALTEENPSDRMTTLSMLQMSIQMALFTEVQQLLRSPIVIQFCEENGWAV
Ga0214169_1011692F010534AGAAGGMSDKVGEKQEAIMNLIDQQIKESLKDQASRLEILQDRIKDAIDISTTEHSQGIKQVMLFVTKAHVQAWITSLKHKVDTAGDCEICDLEKILGEESLEIAEAVKVALSNRNEETRNRILGELLEKTITKIEALSVRVSPAP
Ga0214169_1011694F036561N/AKRRKEFRSLLVSVEQTLSTSMRRVHRKVIELRKENSKISKEVLELEFDLERIREVVMSPNLEQMRTLIENIYDWKVYRQSRSEKDTENLQSIAAAEERVDLSESLEVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.