Scaffold Ga0213495_10053845

Overview

Basic Information

• Taxon OID: 3300020588
• Scaffold ID: Ga0213495_10053845
• Source Dataset Name: Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 606
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.6622
  • Long. (^o): -119.6197

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078199	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213495_100538451	F078199	N/A	MLGYDFEIIYKKGKQNVIANALSRKDEDVEALLCTIYIIQSDWINKARDE