NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213495_10012506

Scaffold Ga0213495_10012506


Overview

Basic Information
Taxon OID3300020588 Open in IMG/M
Scaffold IDGa0213495_10012506 Open in IMG/M
Source Dataset NameLeaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)956
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.6622Long. (o)-119.6197Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038985Metagenome / Metatranscriptome164Y

Sequences

Protein IDFamilyRBSSequence
Ga0213495_100125062F038985N/AGSGSLGPKKLLKIVNYAIVKETEKLKETVVGVQMG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.