Scaffold Ga0213495_10011850

Overview

Basic Information

• Taxon OID: 3300020588
• Scaffold ID: Ga0213495_10011850
• Source Dataset Name: Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 974
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Anacardiaceae → Pistacia → Pistacia vera (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.6622
  • Long. (^o): -119.6197

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023843	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213495_100118502	F023843	GGTGG	MVSSGKIEIENFNGQSFELWKLKMEDLLVDKDQWVMVDPGTKPTGVSDEE