NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207909_1000850

Scaffold Ga0207909_1000850


Overview

Basic Information
Taxon OID3300020572 Open in IMG/M
Scaffold IDGa0207909_1000850 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9048
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (80.95%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040597Metagenome / Metatranscriptome161Y
F087184Metagenome / Metatranscriptome110N
F093301Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0207909_100085016F040597N/AMKKNEAAGIWEIRDARTGERISKFRARKRADVTRYLEMARIGLKRPIEDFEAVFITEWE
Ga0207909_10008503F093301AGGALPSAWIGVLPGEEPMTTLVAIQGDGWSVIGCDSRSSDESGRYLEMATHKVVENNGILIAGSGAGRGSNILQFGWRAPRPKAGQDLDVFMTKVFIPSMRKVFIESGYDMKADGEAAAHDSEFIVSIHGVLYPVYEDYSWDREERNVYHSGSGSDLALGVLEALNYQKCKTAKEAEKIVYRAVEIAIKHDIYSGGNVHTFIQEE
Ga0207909_10008504F087184AGGAMNIGELTSEIESGTFDSDLIKIKEAVDARLKASRTSRTLADFNIGDTVVFNDLTATRYMVGQKATVTGMKQKKVTVRLETPVGRFAHINPVTGRVESSNITVPVAIIDLVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.