NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208465_1026920

Scaffold Ga0208465_1026920


Overview

Basic Information
Taxon OID3300020570 Open in IMG/M
Scaffold IDGa0208465_1026920 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)748
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018349Metagenome / Metatranscriptome235Y
F042890Metagenome / Metatranscriptome157Y
F047643Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0208465_10269201F047643N/AMYYQLRAPNGAALKAAYWEAEFSGLDPYYLEDNAFELGTGSIEKVSSLISKYKLDILVESDYQPTGYRR
Ga0208465_10269202F018349AGGAGGMEYKDGFEDGVKFTREVIINNIRQWAETHDEGATLDWIADKIEFGTLNHDL
Ga0208465_10269204F042890AGGAVGDRANFVFVQPGGNTIVLYGHWAGHNMLANLAEAIAKAQSRWNDPSYATR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.