Scaffold Ga0208229_1011192

Overview

Basic Information

• Taxon OID: 3300020569
• Scaffold ID: Ga0208229_1011192
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1716
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (12.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025027	Metagenome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208229_10111927	F025027	N/A	MDSIEHDVKVLKRVLNSELFLGKYPVISRVWVEEYGNDRIDIVLNVKEPYSEYSPFRDEIRSYIWNIAKMAGVTSRFNIYP