Scaffold Ga0207942_1003176

Overview

Basic Information

• Taxon OID: 3300020549
• Scaffold ID: Ga0207942_1003176
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2583
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037724	Metagenome / Metatranscriptome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207942_10031763	F037724	N/A	MNTKEALMQIRALFEDMPQVVEPMVPVAPVAAEVTKVEMAEYSLVDGTKVMISALEIGGMVEMADGTPAPMGEHQLMDGTSIQVDESGAIVEISSPKQDVIVEEPVAPAAPVPPAQDTDAMIAELKNDYEKKKMELDAKIAELESKVKNGFAQVAELVQALSNTPTAEPTQKASNAFQSYVSTNDSKYERLEKYRNAILNK