Scaffold Ga0207942_1002575

Overview

Basic Information

• Taxon OID: 3300020549
• Scaffold ID: Ga0207942_1002575
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2998
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (30.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099218	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207942_10025758	F099218	N/A	MTDVVKLMFDVEEGNASALDAFCHLTRIEKQIKAAKEQIQSQAINEAQMYGKTFQHMGFEIQCRSGAGRWKFDHLDEWVVAKNQLSAVEDMAKWAYKSEEKGVLPVTDGGEIIQPAVYVAGSDTIALKEIEK