NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207937_1013858

Scaffold Ga0207937_1013858


Overview

Basic Information
Taxon OID3300020544 Open in IMG/M
Scaffold IDGa0207937_1013858 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1495
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007918Metagenome / Metatranscriptome342Y
F008991Metagenome / Metatranscriptome324N
F010534Metagenome / Metatranscriptome302N

Sequences

Protein IDFamilyRBSSequence
Ga0207937_10138582F008991N/AMHLTVKITEQVEKKLEAVLKGKYDNKTIWMYYKVSLQLLRDIIENLIACHHTTYPLAEKDLYYEQNKVQIVDWIQWIQNRTSSDKLVDLDKLLSKLIKDKAENLVEALTEENPSDRMTTLSMLQMSIQMALFTEVQQLLRSPIVIQFCEENGWAV
Ga0207937_10138583F010534AGAAGGMSDRIGEKQESIMNLIDQQIKEALKDQASRLEILQDRIKDAIDISTTEHSQGIKQVMLFVTKAHVQAWITSLKHKVDTAGDCEICDLEKILGEESLEIAEAIKVALSNRNEETRNRILGELLEKTITKIEALSVRVSPAP
Ga0207937_10138584F007918N/ALSSIKQELLSILANVESVTEAMNRAVLKEEDRREQFRTLCSLIDHSFGENIGMIEKRKDDLKEIDPSLQAIDCKLSTRMERLRNVAIKPDLKSMKIEMEKVLSQQRIEKFQTNPQQEEQRPQKG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.