NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207937_1012002

Scaffold Ga0207937_1012002


Overview

Basic Information
Taxon OID3300020544 Open in IMG/M
Scaffold IDGa0207937_1012002 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1670
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013275Metagenome / Metatranscriptome272N
F023279Metagenome / Metatranscriptome210N

Sequences

Protein IDFamilyRBSSequence
Ga0207937_10120022F023279GAGMADSSKENTEAIVDTIKSELAIGFKNCIDKIDTEKKVVDRYNWEIYVKINKILHNSRRLDPQWAIEGDIGNSWSLRSILERDFKSKILNIDLSEIDSIDLEGYEELHQSLKDLRTNNPGWSINKTRRSSPILLTPTQIGLQEESTS
Ga0207937_10120025F013275GGAMDDFINPYKDVKLKTHLLWMTLSTIANYSSAGNISSKYVRAYLAIMVWLLITFNSDRSGAQRLIMAFLYLEFNSIDRIIEAVNHSAIIIKAAMLCMGLSSILVNPEMNYEQAIVLTILL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.